<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26015
| Description |
Uncharacterized protein |
| Sequence | MERSQATSANLMDTHNRLIADILTHYRTLMMLATIQAEGERSNSNPETISVAGISMEMAFDGLYSSIKELLALSRRIKELWVFGPLNQGDTQSQAKEDRIDRDVSEVAGLLDMIDANAMKKLAERCGGTWELQERPTEAAPTTGS |
| Length | 145 |
| Position | Head |
| Organism | Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium solani species complex> Fusarium vanettenii.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.393 |
| Instability index | 37.92 |
| Isoelectric point | 4.83 |
| Molecular weight | 16045.96 |
| Publications | PubMed=19714214
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26015
No repeats found
No repeats found
|