<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26014
| Description |
Predicted protein |
| Sequence | MGDRLTQLQDAVDQLAQQFVACLHYVNKRHDLETFGPNDKIRDVKDAPKEVDSLPPDEFRAGMVELSQDLILKEQQIEVLISSLPGLDNSEMDQERYIKELEEDLKVAEAQRQEAIKEKDQILSELDSVISSIRRP |
| Length | 136 |
| Position | Middle |
| Organism | Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium solani species complex> Fusarium vanettenii.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.642 |
| Instability index | 59.51 |
| Isoelectric point | 4.50 |
| Molecular weight | 15589.35 |
| Publications | PubMed=19714214
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP26014
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.13| 12| 33| 65| 76| 1
---------------------------------------------------------------------------
65- 76 (19.94/11.80) ELSQDLILKEQQ
100- 111 (19.20/11.15) ELEEDLKVAEAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.91| 21| 37| 3| 23| 2
---------------------------------------------------------------------------
3- 23 (36.50/24.09) DRLTQLQDA...VDQL.AQQFVACL
39- 63 (27.41/16.59) DKIRDVKDApkeVDSLpPDEFRAGM
---------------------------------------------------------------------------
|