<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25999
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MYEVFLTAIVDDSSFGPACAVLSGLCGMRPWESFQRVLYFHGPPRAGGMTHLANVDKPMRKDVTFLWKEISQNLLRQSYVIQARYDIAKERQTSPMDLITTPGMLRWTDFPEPPHGRPMLTQRKKTEIWDQRNLPVVMRDNNYQFKTEIVEEVHRFYRDDVEFCLFRSYFLHPQNRYVSAESKTEQFPPLDSLPPLDSLVPIDMEKRWFLHVKAHVMSENKPDDLRKAQDQLLAIRAELEGVFDFRSIDRKVYDTRIAQQAQGIQALPQKVVIGRG |
Length | 276 |
Position | Head |
Organism | Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium solani species complex> Fusarium vanettenii.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.485 |
Instability index | 49.09 |
Isoelectric point | 7.74 |
Molecular weight | 32232.63 |
Publications | PubMed=19714214
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25999
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.48| 13| 37| 167| 179| 2
---------------------------------------------------------------------------
167- 179 (24.75/15.72) RSYFLHPQNRYVS
206- 218 (24.74/15.71) KRWFLHVKAHVMS
---------------------------------------------------------------------------
|