<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25987
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MPVTGLYFIPANQNSPTATRAVIERLRDAYNPTFCGRWALEHRLLRDTPSCLPPSDYAPLPPLQPRFMQFLSLSHRQPYGFIYISDRPDPDPWDSTSSSAKHAGHAQQQQYQQTSQQHQQSHQNPTPQAPDPSPSGPKTMMILDYPSYQSFHAITLRACEPLWCPRHTLTVLNGSHYEINDFRIRIGDVRQTAPQTRVRGTIVEIEYRGPAGTATPPRRRRDSHCHCARR |
Length | 230 |
Position | Head |
Organism | Ajellomyces capsulatus (strain H143) (Darling's disease fungus) (Histoplasma capsulatum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.805 |
Instability index | 72.64 |
Isoelectric point | 9.30 |
Molecular weight | 26264.21 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25987
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 158.53| 38| 41| 53| 92| 1
---------------------------------------------------------------------------
32- 51 (23.67/ 7.41) ...........PTFCGRWALEHR......LLRDTPSC..
54- 92 (67.78/30.05) PSDYAPLPPLQPRFMQFLSLSHRQPYGfIYISDRPDPDP
97- 134 (67.07/26.16) SSSAKHAGHAQQQQYQQTSQQHQQSHQ.NPTPQAPDPSP
---------------------------------------------------------------------------
|