<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25983
| Description |
Uncharacterized protein |
| Sequence | MFGPDPKNPSPTATTSTTQKRLPQPTTPAAADAQAQQQEPSPAEPTPDPPEIFALRQRELARDLIVKEQQIEYLISVLPGVGSSEAEQEERIRRLAEELRVVEAERREKRRQMRKLGERVDELLGAVEGTG |
| Length | 131 |
| Position | Middle |
| Organism | Ajellomyces capsulatus (strain H143) (Darling's disease fungus) (Histoplasma capsulatum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.886 |
| Instability index | 72.14 |
| Isoelectric point | 5.06 |
| Molecular weight | 14608.22 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25983
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.41| 16| 18| 11| 28| 1
---------------------------------------------------------------------------
13- 28 (28.34/15.26) ATTSTTQKRLPQPTTP
30- 45 (28.06/ 9.22) AADAQAQQQEPSPAEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.39| 15| 18| 87| 103| 2
---------------------------------------------------------------------------
87- 103 (19.99/15.25) EQEERIRRLAEelRVVE
108- 122 (25.40/13.33) EKRRQMRKLGE..RVDE
---------------------------------------------------------------------------
|