<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25972
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MASISPEQLKVLEQTRQRLVQLTQSLASLINNINQSDPLPSWSSLQSQATIISNNLVNVSQQLTGHHDLLSSLVAYPTPQFPGRTEAAMLSQLLRTKLEPRVEDWVSQGLSMGNPDATRLRTGLTEQQLLELWRWGPIEANMEARGRNWGGDYTLEEKEMGVKNVVTGLKRKLNEEDSGSESGSGDEEEGLEGEEGGDGGGNGMGVVGVHGSPGAGGVQFDISKEGGYVQSTSMSPALPSEDVFRFMMTGAVPKGR |
Length | 256 |
Position | Head |
Organism | Ajellomyces capsulatus (strain H143) (Darling's disease fungus) (Histoplasma capsulatum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.507 |
Instability index | 57.42 |
Isoelectric point | 4.76 |
Molecular weight | 27609.46 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25972
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.06| 17| 17| 183| 199| 1
---------------------------------------------------------------------------
183- 199 (30.51/17.87) GSGDEEEGLEGEEGGDG
201- 217 (30.55/17.90) GNGMGVVGVHGSPGAGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.01| 12| 17| 62| 73| 2
---------------------------------------------------------------------------
62- 73 (21.40/14.13) QLTGHHD..LLSSL
80- 93 (17.61/10.42) QFPGRTEaaMLSQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.99| 16| 16| 142| 157| 3
---------------------------------------------------------------------------
142- 157 (29.40/18.59) MEARGRNWGGDYTLEE
160- 175 (25.59/15.33) MGVKNVVTGLKRKLNE
---------------------------------------------------------------------------
|