<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25968

Description Uncharacterized protein
SequenceMEADERAEEARRAKEAGNDAYRKSFLETAVEHYTRGGLLDPRDISFLTNRAAAYFRLGKYKECVRDCDEAVKRGRDLSADNKLVAKALLRKASALLELAACSGDYAPAIRALEQSLTEHYSEETHEMLNRAVVVQKELEEQERLDQEMADQHREKGNELFKQKQYHEAAIHYTRATKMNPKDPKAFSNRAQCHIYLGALPQGLEDAQKCVELDPTFLKGYVRKAKVQFLMENYENAMATYLEGLRCDPNNLEVLDGLRRCAACIKRANGGDVELKDLKEMLGDFQSENDLLKFRKATEQATILKKEASDERLKRIESERMARTMEEYLSGVQQESERLKKQHHEVMEKLLKANMDNEHLQGQLSESRGQYEQILSEHDRLLHERNHAVREVQELRQKRGQMLSVLVTAMHCEFSSSELEHATDNFSSSLKIGEGGFGCVYKGTLRNMTVAIKVLKPDGLQGQSQFEQEVAILSRVRHPHLVTLLGACSEISTLVYEFLPNGSLEDFLMCAEKRQTLSWQIRIRIISEICSALTFLHKNKPHPVVHGDLKPANILLDVNLVSKLSDFGISRHLIQSSTNNTTMYHTMHPMGTLQYMDPEFFATGELTCQSDIYSFGIVVLRLLTGKPPDGIKRIVEDAMEKGDLNSVVDTSAGEWPVVHVQQLALLALSCTELSRKSRPDLSAVVWAVVEAMKDAATIPSASSSRSVSDENSTPSYFICPISQDVMDDPHIAADGFTYEAEAIRSWLDSGHDTSPMTNMRLEHDELIPNRALRSAILEWLQQQNTAL
Length786
PositionTail
OrganismSorghum bicolor (Sorghum) (Sorghum vulgare)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
Aromaticity0.06
Grand average of hydropathy-0.479
Instability index44.26
Isoelectric point5.72
Molecular weight88818.80
Publications
PubMed=19189423
PubMed=29161754

Function

Annotated function
GO - Cellular Component
plasma membrane	GO:0005886	IEA:UniProtKB-SubCell
plastid	GO:0009536	IEA:UniProtKB-KW
thylakoid	GO:0009579	IEA:UniProtKB-KW
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP25968
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.87|      24|      30|     341|     369|       1
---------------------------------------------------------------------------
  341-  369 (32.18/30.89)	QHhevmEKLLKA.NMDNEHLQgQLSESRGQ
  376-  400 (35.69/18.87)	EH....DRLLHErNHAVREVQ.ELRQKRGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.85|      24|      91|     231|     254|       2
---------------------------------------------------------------------------
  231-  254 (42.82/29.57)	ENYENAMATYLEGLRCDPNNL.....EVL
  318-  346 (35.03/22.82)	ERMARTMEEYLSGVQQESERLkkqhhEVM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.74|      20|     129|     147|     170|       4
---------------------------------------------------------------------------
  147-  166 (35.51/29.94)	EMADQHREKGNELFKQK.QYH
  173-  193 (32.22/16.25)	TRATKMNPKDPKAFSNRaQCH
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP25968 with Med32 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) TMEEYLSGVQQESERLKKQHHEVMEKLLKANM
323
354

Molecular Recognition Features

MoRF SequenceStartStop
NANANA