<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25963
| Description |
Uncharacterized protein |
| Sequence | MEATVDHLSAAYDDFMAAAAAVVEARAQSGGEKKTAATDAALEAFKQRWELFRVACDHAEELVESIRQRIGSECLVDEATGSASAGSAAAPGIKPISAVRLEQMSKAVRWLVIELQHGTSAQGAGGSGGAATPNAGAGGQHPEEGGQ |
| Length | 147 |
| Position | Tail |
| Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.197 |
| Instability index | 49.22 |
| Isoelectric point | 4.92 |
| Molecular weight | 15004.43 |
| Publications | PubMed=19189423
PubMed=29161754
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25963
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.23| 17| 18| 32| 48| 1
---------------------------------------------------------------------------
32- 48 (27.47/18.04) EKKTAATDAA...LEAFKQR
50- 69 (23.75/14.65) ELFRVACDHAeelVESIRQR
---------------------------------------------------------------------------
|