<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25960

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMADAESNPGAGGKPPPYKDPDNGSQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKHIMYPHCLFFLELLQNANFRNAMAHPTNKELAHRQQYFFWKNYRNNRLKHILPRPPPEPTPAPAPSQAPATLPLPASVPTPVAPPVPGPTSSMPPVVAGGASAMSPMQFVGTPGTNMPKNDMRNAMGNRKRKMG
Length208
PositionMiddle
OrganismSorghum bicolor (Sorghum) (Sorghum vulgare)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
Aromaticity0.11
Grand average of hydropathy-0.608
Instability index57.70
Isoelectric point9.52
Molecular weight23420.68
Publications
PubMed=19189423
PubMed=29161754

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364129
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP25960
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.37|      14|      19|     126|     139|       1
---------------------------------------------------------------------------
  126-  139 (31.34/11.59)	LPRPPPEPTP..APAP
  146-  161 (25.04/ 7.97)	LPLPASVPTPvaPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.63|      10|      18|      42|      57|       2
---------------------------------------------------------------------------
   42-   51 (19.35/19.51)	YIHYLAQNRY
   63-   72 (21.28/ 6.13)	YLKYWQRPEY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.62|      15|      58|      27|      41|       3
---------------------------------------------------------------------------
   27-   41 (28.53/20.08)	FLLEL....EFVQCLANPT
   83-  101 (24.09/15.95)	FFLELlqnaNFRNAMAHPT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25960 with Med31 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) HILPRPPPEPTPAPAPSQAPATLPLPASVPTPVAPPVPGPTSSMPPVVAGGASAMSPMQFVGTPGTNMPKNDMRNAMGNRKRKMG
124
208










Molecular Recognition Features






MoRF SequenceStartStop




1) WKNYRNN
114
120