<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25960
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MADAESNPGAGGKPPPYKDPDNGSQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKHIMYPHCLFFLELLQNANFRNAMAHPTNKELAHRQQYFFWKNYRNNRLKHILPRPPPEPTPAPAPSQAPATLPLPASVPTPVAPPVPGPTSSMPPVVAGGASAMSPMQFVGTPGTNMPKNDMRNAMGNRKRKMG |
| Length | 208 |
| Position | Middle |
| Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.608 |
| Instability index | 57.70 |
| Isoelectric point | 9.52 |
| Molecular weight | 23420.68 |
| Publications | PubMed=19189423
PubMed=29161754
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25960
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.37| 14| 19| 126| 139| 1
---------------------------------------------------------------------------
126- 139 (31.34/11.59) LPRPPPEPTP..APAP
146- 161 (25.04/ 7.97) LPLPASVPTPvaPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.63| 10| 18| 42| 57| 2
---------------------------------------------------------------------------
42- 51 (19.35/19.51) YIHYLAQNRY
63- 72 (21.28/ 6.13) YLKYWQRPEY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.62| 15| 58| 27| 41| 3
---------------------------------------------------------------------------
27- 41 (28.53/20.08) FLLEL....EFVQCLANPT
83- 101 (24.09/15.95) FFLELlqnaNFRNAMAHPT
---------------------------------------------------------------------------
|