<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25952

Description Uncharacterized protein
SequenceMECVVQGIIETQHVEALEVLLQGLSGVPKERVRVHELCLKSGPNLGVVPSEVRLLCDLAQPTPSWTIRHVGGAMRGAGAEQISVLVRTIVESKASKNVLHYFYTLGYKLDHELLKIGFAFRFHRGAQITVTVTSTNKMPRLHATDEAVPVTPGIQLVEITAPAAADNYNDVVSAVSAFCEYLAPLLHLSKPGHSTGIVATAGAAAASLMSSGGGKTL
Length217
PositionHead
OrganismSorghum bicolor (Sorghum) (Sorghum vulgare)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
Aromaticity0.05
Grand average of hydropathy0.210
Instability index30.45
Isoelectric point7.12
Molecular weight23044.38
Publications
PubMed=19189423
PubMed=29161754

Function

Annotated function 
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central

GO - Biological Process
carpel development	GO:0048440	IEA:EnsemblPlants
negative regulation of transcription, DNA-templated	GO:0045892	IEA:EnsemblPlants
petal development	GO:0048441	IEA:EnsemblPlants
production of miRNAs involved in gene silencing by miRNA	GO:0035196	IEA:EnsemblPlants
regulation of defense response to fungus	GO:1900150	IEA:EnsemblPlants
regulation of DNA-templated transcription, elongation	GO:0032784	IEA:EnsemblPlants
regulation of DNA-templated transcription, initiation	GO:2000142	IEA:EnsemblPlants
regulation of DNA-templated transcription, termination	GO:0031554	IEA:EnsemblPlants
regulation of histone H3-K36 trimethylation	GO:2001253	IEA:EnsemblPlants
regulation of photoperiodism, flowering	GO:2000028	IEA:EnsemblPlants
regulation of salicylic acid mediated signaling pathway	GO:2000031	IEA:EnsemblPlants
regulation of timing of transition from vegetative to reproductive phase	GO:0048510	IEA:EnsemblPlants
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central
regulation of vernalization response	GO:0010219	IEA:EnsemblPlants
response to abscisic acid	GO:0009737	IEA:EnsemblPlants
response to ethylene	GO:0009723	IEA:EnsemblPlants
sepal development	GO:0048442	IEA:EnsemblPlants
specification of floral organ number	GO:0048833	IEA:EnsemblPlants
stamen development	GO:0048443	IEA:EnsemblPlants
termination of RNA polymerase II transcription	GO:0006369	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25952
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     140.86|      42|     121|      44|      85|       1
---------------------------------------------------------------------------
   44-   85 (73.89/45.18)	NLGVVPSEVRLLCDLAQPTPSWT.IRHVGGAMRGAGAEQISVL
  167-  209 (66.97/40.35)	NYNDVVSAVSAFCEYLAPLLHLSkPGHSTGIVATAGAAAASLM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25952 with Med18 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




NANANA