<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25952

Description Uncharacterized protein
SequenceMECVVQGIIETQHVEALEVLLQGLSGVPKERVRVHELCLKSGPNLGVVPSEVRLLCDLAQPTPSWTIRHVGGAMRGAGAEQISVLVRTIVESKASKNVLHYFYTLGYKLDHELLKIGFAFRFHRGAQITVTVTSTNKMPRLHATDEAVPVTPGIQLVEITAPAAADNYNDVVSAVSAFCEYLAPLLHLSKPGHSTGIVATAGAAAASLMSSGGGKTL
Length217
PositionHead
OrganismSorghum bicolor (Sorghum) (Sorghum vulgare)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
Aromaticity0.05
Grand average of hydropathy0.210
Instability index30.45
Isoelectric point7.12
Molecular weight23044.38
Publications
PubMed=19189423
PubMed=29161754

Function

Annotated function
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central
GO - Biological Process
carpel development	GO:0048440	IEA:EnsemblPlants
negative regulation of transcription, DNA-templated	GO:0045892	IEA:EnsemblPlants
petal development	GO:0048441	IEA:EnsemblPlants
production of miRNAs involved in gene silencing by miRNA	GO:0035196	IEA:EnsemblPlants
regulation of defense response to fungus	GO:1900150	IEA:EnsemblPlants
regulation of DNA-templated transcription, elongation	GO:0032784	IEA:EnsemblPlants
regulation of DNA-templated transcription, initiation	GO:2000142	IEA:EnsemblPlants
regulation of DNA-templated transcription, termination	GO:0031554	IEA:EnsemblPlants
regulation of histone H3-K36 trimethylation	GO:2001253	IEA:EnsemblPlants
regulation of photoperiodism, flowering	GO:2000028	IEA:EnsemblPlants
regulation of salicylic acid mediated signaling pathway	GO:2000031	IEA:EnsemblPlants
regulation of timing of transition from vegetative to reproductive phase	GO:0048510	IEA:EnsemblPlants
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central
regulation of vernalization response	GO:0010219	IEA:EnsemblPlants
response to abscisic acid	GO:0009737	IEA:EnsemblPlants
response to ethylene	GO:0009723	IEA:EnsemblPlants
sepal development	GO:0048442	IEA:EnsemblPlants
specification of floral organ number	GO:0048833	IEA:EnsemblPlants
stamen development	GO:0048443	IEA:EnsemblPlants
termination of RNA polymerase II transcription	GO:0006369	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP25952
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     140.86|      42|     121|      44|      85|       1
---------------------------------------------------------------------------
   44-   85 (73.89/45.18)	NLGVVPSEVRLLCDLAQPTPSWT.IRHVGGAMRGAGAEQISVL
  167-  209 (66.97/40.35)	NYNDVVSAVSAFCEYLAPLLHLSkPGHSTGIVATAGAAAASLM
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP25952 with Med18 domain of Kingdom Viridiplantae

Unable to open file!