| Description | Uncharacterized protein |
| Sequence | MECVVQGIIETQHVEALEVLLQGLSGVPKERVRVHELCLKSGPNLGVVPSEVRLLCDLAQPTPSWTIRHVGGAMRGAGAEQISVLVRTIVESKASKNVLHYFYTLGYKLDHELLKIGFAFRFHRGAQITVTVTSTNKMPRLHATDEAVPVTPGIQLVEITAPAAADNYNDVVSAVSAFCEYLAPLLHLSKPGHSTGIVATAGAAAASLMSSGGGKTL |
| Length | 217 |
| Position | Head |
| Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | 0.210 |
| Instability index | 30.45 |
| Isoelectric point | 7.12 |
| Molecular weight | 23044.38 |
| Publications | PubMed=19189423 PubMed=29161754 |
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | carpel development GO:0048440 IEA:EnsemblPlants negative regulation of transcription, DNA-templated GO:0045892 IEA:EnsemblPlants petal development GO:0048441 IEA:EnsemblPlants production of miRNAs involved in gene silencing by miRNA GO:0035196 IEA:EnsemblPlants regulation of defense response to fungus GO:1900150 IEA:EnsemblPlants regulation of DNA-templated transcription, elongation GO:0032784 IEA:EnsemblPlants regulation of DNA-templated transcription, initiation GO:2000142 IEA:EnsemblPlants regulation of DNA-templated transcription, termination GO:0031554 IEA:EnsemblPlants regulation of histone H3-K36 trimethylation GO:2001253 IEA:EnsemblPlants regulation of photoperiodism, flowering GO:2000028 IEA:EnsemblPlants regulation of salicylic acid mediated signaling pathway GO:2000031 IEA:EnsemblPlants regulation of timing of transition from vegetative to reproductive phase GO:0048510 IEA:EnsemblPlants regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central regulation of vernalization response GO:0010219 IEA:EnsemblPlants response to abscisic acid GO:0009737 IEA:EnsemblPlants response to ethylene GO:0009723 IEA:EnsemblPlants sepal development GO:0048442 IEA:EnsemblPlants specification of floral organ number GO:0048833 IEA:EnsemblPlants stamen development GO:0048443 IEA:EnsemblPlants termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP25952
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 140.86| 42| 121| 44| 85| 1
---------------------------------------------------------------------------
44- 85 (73.89/45.18) NLGVVPSEVRLLCDLAQPTPSWT.IRHVGGAMRGAGAEQISVL
167- 209 (66.97/40.35) NYNDVVSAVSAFCEYLAPLLHLSkPGHSTGIVATAGAAAASLM
---------------------------------------------------------------------------
|