<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25928
| Description |
Mediator of RNA polymerase II transcription subunit 14 |
| Sequence | MRGKKKKILQPKDNPNFFFFFSFLISLFLHPFLYSPILFYRRTHLSVDQQHTIVRMDQHSNGSPNGKLEATSSSTPDIPHVTANILPLSNILKFYTQEAYKQLTTAVENLSMNVEDESDIKRKKYFLDIIISLRQDFIKVYTLIKWASISKDVSKFIDLLNWFRLQEFQFENLMFQLNGLTGYSGAKLPNSDILTALEVLYKGRPTLPSYNHIKIKNLSSEKILEVLEDLNLVLMTRFALMDVPKKFQYEIKDGRVYITVSNEFEVSITVGNDMIIDKKEDYYKSPFYFIDFKFLFGINPETSMITYHDDKVFTRLPASSHGKLEKIANQVLLKEGLEGLYDLLHRYSTSFKIYLIAKQFKELLNTRWRNNVQINYQTGKSLIIVNYWSSHYLSKNWKSFLELGIDRNSNLSYRWFKNGQYCVDEELNKIFHIIPQDNLNDTGNASNNSNSNNNNSNTNEDGVDEESYSDDLNVDLILNVVVNKHAELLMGMIYEQLLDKFGEDEVSMVTPHQLLLQISPNKSTVFAINPLTGVLLFH |
| Length | 538 |
| Position | Tail |
| Organism | Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.295 |
| Instability index | 28.07 |
| Isoelectric point | 6.41 |
| Molecular weight | 62502.69 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25928
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.70| 13| 203| 296| 309| 1
---------------------------------------------------------------------------
296- 309 (22.68/18.37) FGiNPETSMITYHD
501- 513 (26.02/16.07) FG.EDEVSMVTPHQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.66| 21| 26| 180| 200| 4
---------------------------------------------------------------------------
180- 200 (34.62/28.41) LTGYSGAKLPNSDILTALEVL
207- 227 (35.04/28.86) LPSYNHIKIKNLSSEKILEVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 121.53| 36| 44| 345| 382| 5
---------------------------------------------------------------------------
345- 382 (58.74/43.27) HRYSTSFKIYL.IAKQFKELLNTRWRNNVQinYQTGKSL
391- 427 (62.79/40.03) HYLSKNWKSFLeLGIDRNSNLSYRWFKNGQ..YCVDEEL
---------------------------------------------------------------------------
|