Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MTTGTLSQIPSNEPLIKSAESVSNLIESFIELGVLIHDNQGTLQSNQATINKLNQLINQLNETNNLNETLKDYPIPIDVISYIEDGRNPDIYTREFIEVNAKNNARLKGKMNGFKQLRNVFGEKLKSEFPELSNSVDNIIERTNVEQQTGSNNVINNNNNTNNGLSNGIVESG |
Length | 173 |
Position | Middle |
Organism | Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.621 |
Instability index | 33.36 |
Isoelectric point | 4.75 |
Molecular weight | 19233.06 |
Publications | PubMed=19465905 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25922 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 159.57| 51| 54| 60| 113| 1 --------------------------------------------------------------------------- 60- 113 (79.20/49.84) LneTNNLNETLK.DYPIPIDVISYIEDGRNPDIYTREFIEVNAKNNARlKGKMNG 117- 168 (80.37/42.07) L..RNVFGEKLKsEFPELSNSVDNIIERTNVEQQTGSNNVINNNNNTN.NGLSNG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IYTREFI 2) TLKDYPIPIDVISYI | 91 69 | 97 83 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab