<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25919
| Description |
Uncharacterized protein |
| Sequence | MSADYWNSSQRNQWQLTRFSLLEARRKVLLLERKMIQNGLIKDYPNIIYDYNMRIYLHNLLIKLGRRLNIRQLALATAEIYLTRFLTRVSIKEINVYLLITTCLYVACKIEECPQHIRLIISEARNIWPEYIPHDVTKLAEFEFYLIEEMDSYLLLHHPYKSLIQIRDFLKNNYANYGFKLTEEELQNAWSLINDSYITDVHLLLPPHTIAIAAIYITIVLKKNLSHLRQSNNNSNSNTAVSSSAVNNNNNSGSNSNNNGGGNTVTNNTTNNTTTSTGESNEENGKEMNIDDLMNLTKVTNTKLGDDKMDIDSTNNGQQSQSETQNQNQQTNTDQLNNFDLDILDEDTIKINKFMNFLEHSHINLDEVVEAVQDMMNMYVLWNRYNEQGVKKALQVMLLNRM |
| Length | 402 |
| Position | Kinase |
| Organism | Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.490 |
| Instability index | 42.08 |
| Isoelectric point | 5.63 |
| Molecular weight | 46589.08 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP25919
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.25| 18| 23| 230| 252| 1
---------------------------------------------------------------------------
233- 250 (30.39/17.36) NNSNSNTAVSSSAVNNNN
267- 284 (30.86/ 6.41) NNTTNNTTTSTGESNEEN
---------------------------------------------------------------------------
|