<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25918
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSNENEDLISSLYPPPPPYYKFFTQENKRKLSEWEIEQKQQPGDETAIPPGELRFLVPPKQPDGTQYRGYGNIWLFEDKLPSLKDSQWEQLYVDDDENITSETKIKELHKLMNSLLLNFLELIGVLSIDPSKFETKIKDINLILINLNHLLNTYRPHQSRESLIMLLKKQIDHKKNEIANIDQVCNEIKSKIKKLFDEQIPDVAPETTNVDIVDEKEQMKQDIINKLLQSV |
| Length | 231 |
| Position | Middle |
| Organism | Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.680 |
| Instability index | 50.37 |
| Isoelectric point | 5.02 |
| Molecular weight | 27016.53 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP25918
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.80| 17| 29| 103| 131| 1
---------------------------------------------------------------------------
103- 123 (22.12/34.83) TKIKELhklmNSLLLNFLELI
135- 151 (28.68/11.06) TKIKDI....NLILINLNHLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.74| 24| 26| 169| 194| 2
---------------------------------------------------------------------------
169- 194 (31.75/25.63) KQIDHKKNEIANIDqVCNEiKSKIKK
198- 221 (40.99/23.50) EQIPDVAPETTNVD.IVDE.KEQMKQ
---------------------------------------------------------------------------
|