<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25917
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MEALDEIQWKSPEFIQERGLNTNNVLEYFSLSPFYDRTSNNQVLMMQFQYQQIQIPMGMTFHQYFQTRLSEMTGVEFIIAYTKEPDFWIVRKQKRLDPNNTITLQDYYIIGANVYQAPKIYDVLSSRLLASILSLKNSTDLLNEMTSYHISDGGHSYNNSIHDKMASKSQQSFAVSKSASNNTGINTMTPITLTTPSGATVPSTVSNNNNGVSSNIEITSGAFDSLLNDVVNNDEQVYIDEIPLYGKGSTIESLGLKVNTEN |
| Length | 262 |
| Position | Head |
| Organism | Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.390 |
| Instability index | 37.47 |
| Isoelectric point | 4.81 |
| Molecular weight | 29478.59 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25917
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.71| 20| 25| 176| 199| 1
---------------------------------------------------------------------------
176- 199 (30.13/23.52) SKSASNNTGINTMTPITlttpSGA
203- 222 (34.58/17.62) STVSNNNNGVSSNIEIT....SGA
---------------------------------------------------------------------------
|