Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MEALDEIQWKSPEFIQERGLNTNNVLEYFSLSPFYDRTSNNQVLMMQFQYQQIQIPMGMTFHQYFQTRLSEMTGVEFIIAYTKEPDFWIVRKQKRLDPNNTITLQDYYIIGANVYQAPKIYDVLSSRLLASILSLKNSTDLLNEMTSYHISDGGHSYNNSIHDKMASKSQQSFAVSKSASNNTGINTMTPITLTTPSGATVPSTVSNNNNGVSSNIEITSGAFDSLLNDVVNNDEQVYIDEIPLYGKGSTIESLGLKVNTEN |
Length | 262 |
Position | Head |
Organism | Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.390 |
Instability index | 37.47 |
Isoelectric point | 4.81 |
Molecular weight | 29478.59 |
Publications | PubMed=19465905 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25917 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 64.71| 20| 25| 176| 199| 1 --------------------------------------------------------------------------- 176- 199 (30.13/23.52) SKSASNNTGINTMTPITlttpSGA 203- 222 (34.58/17.62) STVSNNNNGVSSNIEIT....SGA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EQVYIDEIPLY 2) VLEYFSLSPF | 235 25 | 245 34 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab