Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MIPFRKTETPFKSDPISRVNSSSRLNQLGNNTSSPSTPNPASYVTSSLNPQKNLPTNATNVKSKLQTQKDLDIFEQLPMVQKVKEYETLLNELSNDISQFKDDQLQSKIEQIIACNDVLKLQIEELNRHRNYSHQVDKLTEENQALENSSKTILKELVSYRNELKKLPKLPKPDKQLNKSVEVDDILKYAFKLAKFTKAPAAMANMPFQIHPNNYIWPAEDSLRRGMLAQASLQSDEIIRNELGVSEKEEIEKPKEDSDEEMEDVVPSVTENAPPAPDNRQQHRGSFGSYDNNKKQEEPPAAPADLNLDLFDPDDEYSD |
Length | 319 |
Position | Middle |
Organism | Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.926 |
Instability index | 57.35 |
Isoelectric point | 4.98 |
Molecular weight | 36283.06 |
Publications | PubMed=19465905 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25914 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.54| 24| 28| 116| 143| 1 --------------------------------------------------------------------------- 116- 139 (40.00/29.15) NDVLKLQIEELNRHRNYSHQVDKL 147- 170 (37.55/17.90) ENSSKTILKELVSYRNELKKLPKL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.79| 18| 22| 7| 26| 2 --------------------------------------------------------------------------- 7- 26 (28.30/24.14) TETPFKSDPISRVNSSsrLN 32- 49 (33.49/21.46) TSSPSTPNPASYVTSS..LN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MIPFRKT 2) RQQHRGSFGSYDNNKKQEEPPAAPADLNLDLFDPDDEYSD | 1 280 | 7 319 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab