<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25914
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MIPFRKTETPFKSDPISRVNSSSRLNQLGNNTSSPSTPNPASYVTSSLNPQKNLPTNATNVKSKLQTQKDLDIFEQLPMVQKVKEYETLLNELSNDISQFKDDQLQSKIEQIIACNDVLKLQIEELNRHRNYSHQVDKLTEENQALENSSKTILKELVSYRNELKKLPKLPKPDKQLNKSVEVDDILKYAFKLAKFTKAPAAMANMPFQIHPNNYIWPAEDSLRRGMLAQASLQSDEIIRNELGVSEKEEIEKPKEDSDEEMEDVVPSVTENAPPAPDNRQQHRGSFGSYDNNKKQEEPPAAPADLNLDLFDPDDEYSD |
| Length | 319 |
| Position | Middle |
| Organism | Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.926 |
| Instability index | 57.35 |
| Isoelectric point | 4.98 |
| Molecular weight | 36283.06 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25914
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.54| 24| 28| 116| 143| 1
---------------------------------------------------------------------------
116- 139 (40.00/29.15) NDVLKLQIEELNRHRNYSHQVDKL
147- 170 (37.55/17.90) ENSSKTILKELVSYRNELKKLPKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.79| 18| 22| 7| 26| 2
---------------------------------------------------------------------------
7- 26 (28.30/24.14) TETPFKSDPISRVNSSsrLN
32- 49 (33.49/21.46) TSSPSTPNPASYVTSS..LN
---------------------------------------------------------------------------
|