<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25907
| Description |
Uncharacterized protein |
| Sequence | MTNSARNGQFYAYRDKQLYMLNLSLSIFKIIAHHPQLLAREATALRSTTTSATMADILTQLQTCLDQLATQFYATLCYLTTYHDHSAATPPSNVPTAIPQLKKIPKNPPPTTTVSTTAKGTSGAAASSQAQQSTTPAAAEAQAQQEESPPAEPTPDTPEIFALRQRELARDLIVKEQQIEYLISVLPGVGSSETEQEERIRRLAEELRVVEAERMEKRREMRRLGERVDELLGAVEGRW |
| Length | 239 |
| Position | Middle |
| Organism | Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) (Blastomyces dermatitidis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.501 |
| Instability index | 58.27 |
| Isoelectric point | 5.89 |
| Molecular weight | 26550.68 |
| Publications | PubMed=26439490
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25907
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.27| 17| 18| 195| 211| 1
---------------------------------------------------------------------------
175- 190 (19.92/10.24) .KEQQIEYLISVLPGVG
195- 211 (27.48/16.27) EQEERIRRLAEELRVVE
216- 230 (24.87/14.19) EKRREMRRLGE..RVDE
---------------------------------------------------------------------------
|