<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25903
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAQSAVPLEEITWRSPLHVQTMGGFLHSNNILFYFAESPFFDQTSNNASLAIQANYNENFRPFIETREAFEGRLKTMQGLEFMVVHDPLQEAAAAAAVGGKQQRKQQELSNIWVIRKQMRKKRTGVGSGAAGGDDEIQVLATYFVVGDSVFMAPSVLRVVGSRMLSAVTSLTRALSVASPLPTFSPSYGHTYMPPVPKSLEASRPGVQQSGQQSVGDAPMPDASSQSKGGSVLSATGTTQQPTASTSPLASSSTTTQDSRSLVEAFNLLSRYGDEYMDDAPLLGEPGSFIIGKTSTEPLVVGMRQPMSSKVSKAPTPAPSAGAGPGASKPGTPAATGGAAAPPAIKTDAATLGAGKAGRGGEKSPTTPGGGKERVKRRKSKVSSATVASLAAGSSAGGS |
Length | 400 |
Position | Head |
Organism | Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) (Blastomyces dermatitidis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.280 |
Instability index | 59.41 |
Isoelectric point | 9.56 |
Molecular weight | 41380.08 |
Publications | PubMed=26439490
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25903
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 272.08| 90| 124| 139| 244| 1
---------------------------------------------------------------------------
139- 244 (130.93/78.67) QVLATYfvvGDSvFM..APsVLRVVGSRMLSA......VTSLTRALSV.ASPLPTFSPSYGHTymPPvpksleASRPGV.QQSGQQSVGDAPMPDASSQSKGGsvlSATGTTQQPT
268- 367 (141.15/56.76) NLLSRY...GDE.YMddAP.LLGEPGSFIIGKtsteplVVGMRQPMSSkVSKAPTPAPSAGAG..PG......ASKPGTpAATGGAAAPPAIKTDAATLGAGK...AGRGGEKSPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.04| 24| 270| 100| 133| 2
---------------------------------------------------------------------------
100- 133 (34.93/35.47) GGKQQRKqqelsniwviRKQMRKKRTGVGSGAAG
371- 394 (39.12/20.19) GGKERVK..........RRKSKVSSATVASLAAG
---------------------------------------------------------------------------
|