<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25896
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHELLLFSPVPAKQHHDLLQQLSGLTAMQPTRTFERRLVFKAYRKPGFIKTRPGGSQDVQAPETQRLNKLLNGGLYYIQVVGNVQERDFGSMPASSSSSSSSSSLPSSSASLRSDVVTQGTGAGGDGTQQGQGSLWSSTPMNHGAATAAVSKGYVAANQSWRLEFKDTPEAGARSGVTSRFVGTANLPSGNILPEMTAWGFDYVSEYVVEGHTFVLDDTVLFLHRVLTFPPSADGGGGGPKTLTPTEYLPPLDKMVLLDTSGAYVLQASITVQDSGNPDMLKANSQRLLGLKEHLKSVVKLEPEDRLSLDTRVK |
| Length | 314 |
| Position | Head |
| Organism | Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) (Blastomyces dermatitidis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Blastomyces.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.322 |
| Instability index | 46.51 |
| Isoelectric point | 7.07 |
| Molecular weight | 33723.56 |
| Publications | PubMed=26439490
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25896
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 213.27| 66| 219| 1| 70| 2
---------------------------------------------------------------------------
1- 70 (105.36/76.16) MHELLLFSPvPAKQHHDLLQQLSGLTAMQPtrtFERRLVF...KAYRKPGFIKTRPGGSQDVQAPETQRLNKL
223- 291 (107.91/66.69) LHRVLTFPP.SADGGGGGPKTLTPTEYLPP...LDKMVLLdtsGAYVLQASITVQDSGNPDMLKANSQRLLGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.74| 19| 35| 147| 165| 3
---------------------------------------------------------------------------
147- 165 (32.17/22.22) TAAVSKGYVAAN.QSWRLEF
184- 203 (30.57/20.77) TANLPSGNILPEmTAWGFDY
---------------------------------------------------------------------------
|