<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25888
| Description |
Cyclin |
| Sequence | MAANYWNSTQRRFWLFDREKLAETRAALEEADRAFIAQYPLPDHRLVNIYINQQLIKLGKRMNTRQQALATAQVYVKRFFTKVSIRRTNPYLLLTTAFYLACKTEECPQHIKYVVSEARGLWPEFILSDAAKVGECEFWLISELNSQLIIHHPYRTLSDFSSTLTNTSSTGLVLSSDEIALAWSVVNDSYLTDLPLLQPPHVIAVMAVFVAVVFKPGTAGSSTSAGMAAGIREGMGDGGRVQKVVEWLAGSEVSIEAVVDCTQEMVALYEVWEGYGEKGLREAIGRYVRGRFLDK |
| Length | 295 |
| Position | Kinase |
| Organism | Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) (Microsporum canis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Arthrodermataceae> Microsporum.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.047 |
| Instability index | 37.89 |
| Isoelectric point | 6.54 |
| Molecular weight | 33169.64 |
| Publications | PubMed=22951933
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25888
No repeats found
|