<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25859
| Description |
ZYRO0D15378p |
| Sequence | MNNQALFEKLDQTTEILSTKLGELVKLASLDDAETSMGSVSTNGLLMVNSQTMQLVKGIQDLLALTRSIREKWLLNQIPEQGTADPEISQDPGQLESLLEKCMQEVLGDH |
| Length | 110 |
| Position | Head |
| Organism | Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Zygosaccharomyces.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.267 |
| Instability index | 28.06 |
| Isoelectric point | 4.35 |
| Molecular weight | 12127.68 |
| Publications | PubMed=19525356
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP25859
No repeats found
No repeats found
|