Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MLSQSEFAPDTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGEPEEEEADATEKQGSGDKNGKEGEETKTGERPASPGAHGNERRQSFVFTENPTETANADNNDEPDDEALDLDLDLFKPDEF |
Length | 295 |
Position | Middle |
Organism | Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Zygosaccharomyces. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.799 |
Instability index | 43.78 |
Isoelectric point | 4.51 |
Molecular weight | 33016.00 |
Publications | PubMed=19525356 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP25858 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.43| 21| 132| 1| 24| 1 --------------------------------------------------------------------------- 1- 24 (33.16/30.33) MLSQSEFAPDTpanIL.SRGHVRSS 136- 157 (32.27/20.24) MLEQVEFEKQS...ILkQRSKVNSS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ERRQSFVFTENPTETANADNNDEPDDEALDLDLDLFKPDEF 2) GKEGEETKTGERPA | 255 234 | 295 247 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab