<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25847
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSSETNDISFLYPPPPPYIKFFTKENLDKLPEYKEQKHTDANADAEVDQNGEEKIESPMDFLVPPPMPKDQYRAFGSIWQVKDRLPDLEASGLTQLYKKPDENNDASTDYQYKIQELRRLLKSLLLNFLELVGVLSINPELFPNKVDHIRIILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKKREIQHIEQVCQNVREKLGRIQEGGDGEPAGGVDVNPVGDETAHTDINTNAN |
| Length | 235 |
| Position | Middle |
| Organism | Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Zygosaccharomyces.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.734 |
| Instability index | 43.67 |
| Isoelectric point | 4.89 |
| Molecular weight | 27061.11 |
| Publications | PubMed=19525356
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP25847
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.01| 23| 52| 10| 32| 1
---------------------------------------------------------------------------
10- 32 (47.27/25.54) FLYPPPPP...YIKFFTKENL.DKLPE
61- 87 (38.74/19.89) FLVPPPMPkdqYRAFGSIWQVkDRLPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.85| 12| 17| 159| 170| 4
---------------------------------------------------------------------------
159- 170 (22.08/13.97) LLNEYRPHQSRE
175- 186 (19.77/11.85) LLEEQLEYKKRE
---------------------------------------------------------------------------
|