Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSSETNDISFLYPPPPPYIKFFTKENLDKLPEYKEQKHTDANADAEVDQNGEEKIESPMDFLVPPPMPKDQYRAFGSIWQVKDRLPDLEASGLTQLYKKPDENNDASTDYQYKIQELRRLLKSLLLNFLELVGVLSINPELFPNKVDHIRIILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKKREIQHIEQVCQNVREKLGRIQEGGDGEPAGGVDVNPVGDETAHTDINTNAN |
Length | 235 |
Position | Middle |
Organism | Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Zygosaccharomyces. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.734 |
Instability index | 43.67 |
Isoelectric point | 4.89 |
Molecular weight | 27061.11 |
Publications | PubMed=19525356 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP25847 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 86.01| 23| 52| 10| 32| 1 --------------------------------------------------------------------------- 10- 32 (47.27/25.54) FLYPPPPP...YIKFFTKENL.DKLPE 61- 87 (38.74/19.89) FLVPPPMPkdqYRAFGSIWQVkDRLPD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.85| 12| 17| 159| 170| 4 --------------------------------------------------------------------------- 159- 170 (22.08/13.97) LLNEYRPHQSRE 175- 186 (19.77/11.85) LLEEQLEYKKRE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) NDISFLYP 2) PYIKFFTKENLDKLPEYK 3) YRAFGSIW | 6 17 72 | 13 34 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab