<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25832
| Description |
KLTH0F07304p |
| Sequence | MADRLTQLQICLDQMMEQFCATLNYIDKNHDFEPARGEEKMTDLQANIASKEEFENTMDELSTDLILKTRQITKLIDSLPGVDVSAEEQMHRIESLQNQLVKMEDRKIEAIKEKEELQRKVEEMIFDFTVGIANARKPAPRSDHEEGP |
| Length | 148 |
| Position | Middle |
| Organism | Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.714 |
| Instability index | 57.69 |
| Isoelectric point | 4.66 |
| Molecular weight | 17140.24 |
| Publications | PubMed=19525356
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25832
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.08| 23| 33| 50| 72| 1
---------------------------------------------------------------------------
50- 72 (37.16/22.02) SKEEFENTMDELSTDLI.LKTRQI
85- 108 (33.92/19.60) SAEEQMHRIESLQNQLVkMEDRKI
---------------------------------------------------------------------------
|