| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSVGGANEIAALYPPPPPYIKYFTDENLTKLEAQRKSGEASEADEDLEFLIPPPVPAEGHYRAFGSVWHVKDELPDLSSMGMTQLYQGSADGTASSYQSKIQELHKLLRSLLLNFLELTGILSINPERFAEKVEHIQTILVNFHHLLNEYRPHQSRESLIMLLEAQLEHKRSEIQHIEQVCSDVRAKLRRLVDGDGPKNEDAPSEPEPQSHVQKEAESLT |
| Length | 220 |
| Position | Middle |
| Organism | Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.550 |
| Instability index | 58.53 |
| Isoelectric point | 5.12 |
| Molecular weight | 24816.62 |
| Publications | PubMed=19525356 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP25831
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.64| 13| 35| 6| 18| 1
---------------------------------------------------------------------------
6- 18 (27.02/16.11) ANE.IAALYPPPPP
43- 56 (21.62/11.61) ADEdLEFLIPPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.11| 11| 27| 108| 118| 2
---------------------------------------------------------------------------
108- 118 (17.38/10.01) LRSLLLNFLEL
136- 146 (19.73/12.10) IQTILVNFHHL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) PYIKYFTDE 2) VQKEAESLT | 18 212 | 26 220 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab