<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25828
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSQGPVPDTGVGVADSQADYDFSHVPAQALDAVRMRLAQLTHSQAKLKDEMARADLPQWHSLQAQVSIILTQLQSLTSTIHHFEETLDSTVVYPLANFPTTAHEGLLTTLLRKKNIPEVDEWINDAKETSGIDINTASHEDIKTALRSDEELTKWALDFLKQEHSNYSYHGFYTARELSAGASPDTQDTYQRAPSSKKPKKPFDANNVLKMIHQGTFS |
Length | 218 |
Position | Head |
Organism | Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.558 |
Instability index | 40.17 |
Isoelectric point | 5.51 |
Molecular weight | 24318.79 |
Publications | PubMed=19525356
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25828
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.88| 15| 16| 31| 46| 1
---------------------------------------------------------------------------
31- 46 (21.97/17.27) DAV.RMRLAQLtHS.QAK
49- 65 (21.92/12.32) DEMaRADLPQW.HSlQAQ
---------------------------------------------------------------------------
|