<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25824
| Description |
Mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MSNRGLLEQLERTTETLSHSLSNLIKYSSVAKERDDEDSGEQHELPESTAKNSTSGLMMVNAQTAQLIKGIQDLLVMTRSIREKWLLTQIPDEGVDSQSELDYEKCSQLLKQWTQEVVSSEE |
| Length | 122 |
| Position | Head |
| Organism | Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.698 |
| Instability index | 42.59 |
| Isoelectric point | 4.62 |
| Molecular weight | 13815.21 |
| Publications | PubMed=19525356
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25824
No repeats found
|