<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25823
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MPQPEFIQERLESLNAVDNQLLSTLLHASQAVGTIEELKRGNENMKSQFENHIRSFYGSLEEATVALRREIRHLDENVGTRLLPINVNKKAVGQDNEKMREQFEHLEHEAS |
| Length | 111 |
| Position | Head |
| Organism | Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.756 |
| Instability index | 57.80 |
| Isoelectric point | 5.35 |
| Molecular weight | 12794.16 |
| Publications | PubMed=19525356
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25823
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.52| 11| 51| 42| 53| 1
---------------------------------------------------------------------------
42- 53 (17.64/15.26) NENMKSQFEnHI
96- 106 (21.88/13.45) NEKMREQFE.HL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.07| 22| 44| 13| 34| 2
---------------------------------------------------------------------------
13- 34 (34.79/21.73) SLNAVDNQLLSTLLHASQAVGT
59- 80 (35.28/22.11) SLEEATVALRREIRHLDENVGT
---------------------------------------------------------------------------
|