<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25816
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MDKQQTPPSQVPVDSLELIRNRLSQVHQSLRKLADQINHTNRNPRSRLPGYSNLQSQFHVLITQLHTIASQLDTNDEILRASTAYPLPSFPTTQHEGLVTTLLRKKPLPEVDEWIESAIAESATFKMPIQKDDSFAEWCYSKVKELEETFNFEGFYTEAELAHLESEEGKKEQSEKEAIAKEKEQAEKRIVGTEAPMSSNQVLRFMHRGIV |
| Length | 211 |
| Position | Head |
| Organism | Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.695 |
| Instability index | 55.41 |
| Isoelectric point | 5.56 |
| Molecular weight | 24159.89 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25816
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.19| 14| 15| 158| 171| 1
---------------------------------------------------------------------------
158- 171 (22.03/15.63) EAELAHLESEEGKK
175- 188 (21.17/14.75) EKEAIAKEKEQAEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.95| 21| 22| 105| 125| 3
---------------------------------------------------------------------------
105- 125 (37.70/27.38) KKPLPEVD...EWIESAIAE.SATF
126- 150 (31.25/21.56) KMPIQKDDsfaEWCYSKVKElEETF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.53| 20| 25| 20| 40| 4
---------------------------------------------------------------------------
20- 40 (30.15/23.68) RNRL...SQVHQSLRKLADQInHT
45- 67 (29.38/17.94) RSRLpgySNLQSQFHVLITQL.HT
---------------------------------------------------------------------------
|