<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25815
| Description |
Uncharacterized protein |
| Sequence | MSADYWASSQRAKWQLTREGLSECRRRLNLLEKKMTQSGLIKDYPHVVYDYHMRIYLHTLLVKLGRRLNVRQIALATSEVYLSRFLTRVSVKEINVYLLVTTCLYVACKIEECPQHIRVITSEARNLWPEYIPHDVTKLAEFEFYLIEEMDMYLFLHHPYGSLLQIRDLLSANESHYGFVLSDDELQHSWSLVNDSYITDLHLLFPPHIIAVAAIYITIVLKKNLNAIRAGSTQVGQSHSSPPKVSMHVDDLMALGSSTNLSAQNFSDTRLDADTEKIDRFMDFFNYSHINLDEVVEAMQEIINLYVAWDRYNENQVRRALQLMLIGR |
| Length | 328 |
| Position | Kinase |
| Organism | Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.140 |
| Instability index | 48.77 |
| Isoelectric point | 6.16 |
| Molecular weight | 38191.41 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP25815
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.48| 15| 15| 54| 68| 1
---------------------------------------------------------------------------
54- 68 (26.05/17.93) RIYLHTLLVKLGRRL
72- 86 (24.43/16.39) QIALATSEVYLSRFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.50| 10| 19| 291| 300| 5
---------------------------------------------------------------------------
291- 300 (16.66/10.80) NLDEVVEAMQ
313- 322 (16.84/10.98) NENQVRRALQ
---------------------------------------------------------------------------
|