<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25814
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MFPHKKDQSFISVPVSRVGSSNRLNQLNNLNVSPSRISSRPGTPGATYVTSSLNPTKNLPVSQNDIQSKIKTPKELEKFNSLCITQSLRQFEEIFTDLSQCISSFKEDAITQKVADLIDVSQSMSSELNVLRQHSDLGKKIDLLSQTQNELDKEAKHILKELISCRSELKRLPKLAAAHDRVDPTNEINEVNVQEVLDYSMKLAKFSKAPATVVSQMIHPNNYIWPAEDALRRGMLAVASLKPDELIQSELGDDTLQARDVDMKDASPEMPESTETYEAKSNDEQKTVAPKDTPKSPGHSKQPTDASLKEESAPNTLDLDLFDPDEDSDSD |
| Length | 331 |
| Position | Middle |
| Organism | Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.684 |
| Instability index | 53.18 |
| Isoelectric point | 4.99 |
| Molecular weight | 36805.76 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25814
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.49| 23| 25| 261| 284| 1
---------------------------------------------------------------------------
261- 284 (36.34/19.59) VDMKDaSPEMP.ESTETYEAKSNDE
288- 311 (36.15/15.97) VAPKD.TPKSPgHSKQPTDASLKEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.83| 21| 26| 24| 44| 2
---------------------------------------------------------------------------
24- 44 (38.53/22.49) LNQLNNLNVSPSRISSRPGTP
53- 73 (38.29/22.31) LNPTKNLPVSQNDIQSKIKTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.79| 18| 31| 134| 163| 3
---------------------------------------------------------------------------
134- 152 (24.78/30.63) HSDLgKKIDLLSQTQNELD
166- 183 (29.01/ 9.20) RSEL.KRLPKLAAAHDRVD
---------------------------------------------------------------------------
|