<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25807
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEELPTRWEVELEFVQSLANIQYVNYLAQNDYLSDPKFIEYLKYLNYWKETKFAKYVVYPNCLHILTLLQNEEFRKSIVNPEFMNTLMNDMVKKWQNVDDVFNPSTDNDEAKADGQNEIKKEENDGADLQSGQIPRPPEIDVDRLG |
| Length | 146 |
| Position | Middle |
| Organism | Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.727 |
| Instability index | 43.95 |
| Isoelectric point | 4.45 |
| Molecular weight | 17245.13 |
| Publications | PubMed=19465905
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25807
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.64| 10| 15| 107| 116| 1
---------------------------------------------------------------------------
107- 116 (18.25/11.64) DNDEAK.ADGQ
123- 133 (14.39/ 7.97) ENDGADlQSGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.63| 18| 18| 49| 66| 2
---------------------------------------------------------------------------
49- 66 (32.23/17.64) KETKFAKYVVYPNCLHIL
70- 87 (31.40/17.06) QNEEFRKSIVNPEFMNTL
---------------------------------------------------------------------------
|