Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEELPTRWEVELEFVQSLANIQYVNYLAQNDYLSDPKFIEYLKYLNYWKETKFAKYVVYPNCLHILTLLQNEEFRKSIVNPEFMNTLMNDMVKKWQNVDDVFNPSTDNDEAKADGQNEIKKEENDGADLQSGQIPRPPEIDVDRLG |
Length | 146 |
Position | Middle |
Organism | Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Metschnikowiaceae> Clavispora. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.727 |
Instability index | 43.95 |
Isoelectric point | 4.45 |
Molecular weight | 17245.13 |
Publications | PubMed=19465905 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25807 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 32.64| 10| 15| 107| 116| 1 --------------------------------------------------------------------------- 107- 116 (18.25/11.64) DNDEAK.ADGQ 123- 133 (14.39/ 7.97) ENDGADlQSGQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.63| 18| 18| 49| 66| 2 --------------------------------------------------------------------------- 49- 66 (32.23/17.64) KETKFAKYVVYPNCLHIL 70- 87 (31.40/17.06) QNEEFRKSIVNPEFMNTL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DLQSGQIPRPPEIDVDRLG 2) KKEEND | 128 120 | 146 125 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab