<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25797
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MANKGGPETEEQTRLRFQVELEFVQCLANPNYLNFLAQRGYFKDQSFINYLKYLLYWKEPDYAKFIKYPMCLYFLDLLQHEPFRKEIATAICSKFIDDQLLLIWQHYTRRRTKLIHTAYEHNMNMMNKSGASNIGQAQTNGTNGIMPASMPIPKVMPP |
| Length | 158 |
| Position | Middle |
| Organism | Acyrthosiphon pisum (Pea aphid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Aphidomorpha>
Aphidoidea> Aphididae> Macrosiphini> Acyrthosiphon.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.434 |
| Instability index | 45.47 |
| Isoelectric point | 8.93 |
| Molecular weight | 18596.36 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25797
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 96.11| 20| 20| 59| 78| 1
---------------------------------------------------------------------------
29- 51 (29.82/14.66) NPNYLNFLAqrgYFKDQSFIN..YL
59- 78 (38.41/20.31) EPDYAKFIK...YPMCLYFLD..LL
81- 101 (27.87/13.38) EP.FRKEIA...TAICSKFIDdqLL
---------------------------------------------------------------------------
|