<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25794
| Description |
ACYPI001314 protein |
| Sequence | MAGNFWQSSHYQQWILDKQDLVRERQLDLQILSEEEYQKIGIFFSNFIQILGEQLKLKQQVIATATVYFKRFYARNSLKSIDPLLLSPTCVFLASKVEEFGVISNSRLITTCQTVLKNKLNYAYTQEFPYRTNHILECEFYLLENLDCCLIVFQPYRPLLQLVQDIGQHEDQLLALAWRVVNDSLRTDLSLLYPPYQIAIGCLQIACVIMQKDLKSWFAELNVDIDKIQEISRYIINLFELWKSYDEKKDIQGLLNKMPKPKLQPTR |
| Length | 267 |
| Position | Kinase |
| Organism | Acyrthosiphon pisum (Pea aphid) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Aphidomorpha>
Aphidoidea> Aphididae> Macrosiphini> Acyrthosiphon.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.127 |
| Instability index | 50.56 |
| Isoelectric point | 6.33 |
| Molecular weight | 31431.15 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25794
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.80| 23| 23| 109| 131| 1
---------------------------------------------------------------------------
89- 103 (18.69/ 7.43) ..TC.VFLASKV.....EEFGVI
109- 131 (41.52/23.81) ITTCQTVLKNKLNYAYTQEFPYR
135- 157 (40.58/23.14) ILECEFYLLENLDCCLIVFQPYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.91| 19| 22| 29| 47| 2
---------------------------------------------------------------------------
29- 47 (33.83/25.50) LQILSEE...EYQKIG...IFFSNF
48- 72 (23.08/15.17) IQILGEQlklKQQVIAtatVYFKRF
---------------------------------------------------------------------------
|