<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25792
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDNICFVDHVFLSSNPLTSENILDYFSTSPFYDKSSINEILKMQNQYRGISTLQQDVSKHKGVFYVLDHYNTDNTLFVIRQSDNDVNLAYFYVIHGHIYKAPTNNKIFNTRVNDIYWYLNEILDSYLDKLMCCNEKTTVEKNEYLSEEVLKDVLIKFNSLYK |
Length | 162 |
Position | Head |
Organism | Nosema ceranae (strain BRL01) (Microsporidian parasite) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Nosematidae> Nosema.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.371 |
Instability index | 48.70 |
Isoelectric point | 5.27 |
Molecular weight | 19159.40 |
Publications | PubMed=19503607
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25792
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.30| 21| 24| 45| 67| 1
---------------------------------------------------------------------------
33- 53 (32.31/14.67) DKSSINEILKMQNQYRGISTL
56- 76 (35.99/23.96) DVSKHKGVFYVLDHYNTDNTL
---------------------------------------------------------------------------
|