Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEDEQHGLISALYPPPPPYLKFFTSKNVEKLKELRETKSDEEIHQQVKGTELQFLIPPTKPEGESYRSFGSVWSFKDKFIDLKASGIQQLYPNFISEENDQDEVFSHERLTEMKKMTKSLLLNFLELLGIVAKNPSYANQKIEHIRIILINLHYLLNSYRLHQSREILILEMESKIQQDKAEIENIETVCARIEEKVRTLVKKNVIIVPEKNGMMEVDDEKETDIEAKRQEVIDSLLEEEYIE |
Length | 243 |
Position | Middle |
Organism | Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Komagataella. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.565 |
Instability index | 55.56 |
Isoelectric point | 5.03 |
Molecular weight | 28481.23 |
Publications | PubMed=19465926 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP25788 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 97.04| 33| 36| 167| 202| 2 --------------------------------------------------------------------------- 167- 202 (44.65/33.65) ILILEMESKIQQDKAEIENIEtvcARIEEKVRTLVK 206- 238 (52.40/30.94) IIVPEKNGMMEVDDEKETDIE...AKRQEVIDSLLE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LISALY 2) PYLKFFT | 8 18 | 13 24 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab