<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25785
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MTSMSAPATTLDQVENELSQLIETLIHLGVQVHDYAGTAESQLGLSNNINKVVEHLQKLHNTDLNIPIPVDVVNYIEDGRNPDIYTREFVEVVRKLNQFLRGKQLGFKYAQSTLGQKIVNEFPELKEQVENIKKRTFIETVPMGTNSS |
| Length | 148 |
| Position | Middle |
| Organism | Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Komagataella.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.382 |
| Instability index | 50.02 |
| Isoelectric point | 5.34 |
| Molecular weight | 16722.76 |
| Publications | PubMed=19465926
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25785
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.48| 25| 37| 11| 35| 1
---------------------------------------------------------------------------
11- 35 (41.85/24.66) LDQVENELSQLIET..LIHLGVQVHDY
49- 75 (38.63/22.35) INKVVEHLQKLHNTdlNIPIPVDVVNY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.70| 22| 38| 82| 106| 2
---------------------------------------------------------------------------
82- 106 (28.70/30.44) PDIytREFVEVVRKlNQFLRGKQLG
123- 144 (38.00/25.70) PEL..KEQVENIKK.RTFIETVPMG
---------------------------------------------------------------------------
|