<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25783

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMLDIGEALLKDDDQDQYLIDNSKLPLSQLIPKIVAERGRFEDLKEDELIDEILENHQQPANETTVQEEDQEDSESFIKQKMEVITAVQTALNESSLLLDLVSLLISCTRPAAGSTSMSPHLKQHAKLGSLNCDDISSNGEVSRLAEENKEKHSIVGLGWKSDALDVASKRLLSASERLNDEVLKEKMYWDNILETLEANEVILKLNSKGGLSNSKEIGVKYGFGDSGSTYFDRGIALLKKGRSFGEIHFNRINNLQVDRDEKVVKVSILSKVDDEYTLTGESNSRKYLDSLKNFQINHTSIVGEIERARFFIFEEEFFHQLLKEATELISYQVQVDGNKIVVDLGEEIIEIESVLAETQLDDNQVPHKELSHNQRADYITIFLRLMLCAHFRSNLENKRHNPTALTVHPPGTPKQKVQLNLLRPLIGNYRHNKHLQLLKNIIEMLIRNIYLDDEKVSEIMGQHFKLTKHLAEPKSQQNQDPFIRCKTPPVSEFLLELPSRSGEFTLKVIITVSATSSFCGLQVRLKMFKILEKDSEMVLDVTFSDVRDVQDCLSWSWNRYL
Length561
PositionHead
OrganismKomagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Komagataella.
Aromaticity0.06
Grand average of hydropathy-0.412
Instability index43.89
Isoelectric point5.24
Molecular weight63993.94
Publications
PubMed=19465926

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25783
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.81|      22|     137|      39|      62|       1
---------------------------------------------------------------------------
   39-   62 (34.69/28.66)	RFED..LKEDELIDEILENHQqpANE
  177-  200 (36.12/22.31)	RLNDevLKEKMYWDNILETLE..ANE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     147.73|      46|     113|     320|     366|       2
---------------------------------------------------------------------------
  320-  366 (69.18/46.09)	QLLKEATELISYQVQVDGNKIVVDLGEEiIEIESVLAETQLDDNQVP
  436-  481 (78.55/48.42)	QLLKNIIEMLIRNIYLDDEKVSEIMGQH.FKLTKHLAEPKSQQNQDP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25783 with Med17 domain of Kingdom Fungi
Unable to open file!