<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25783
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MLDIGEALLKDDDQDQYLIDNSKLPLSQLIPKIVAERGRFEDLKEDELIDEILENHQQPANETTVQEEDQEDSESFIKQKMEVITAVQTALNESSLLLDLVSLLISCTRPAAGSTSMSPHLKQHAKLGSLNCDDISSNGEVSRLAEENKEKHSIVGLGWKSDALDVASKRLLSASERLNDEVLKEKMYWDNILETLEANEVILKLNSKGGLSNSKEIGVKYGFGDSGSTYFDRGIALLKKGRSFGEIHFNRINNLQVDRDEKVVKVSILSKVDDEYTLTGESNSRKYLDSLKNFQINHTSIVGEIERARFFIFEEEFFHQLLKEATELISYQVQVDGNKIVVDLGEEIIEIESVLAETQLDDNQVPHKELSHNQRADYITIFLRLMLCAHFRSNLENKRHNPTALTVHPPGTPKQKVQLNLLRPLIGNYRHNKHLQLLKNIIEMLIRNIYLDDEKVSEIMGQHFKLTKHLAEPKSQQNQDPFIRCKTPPVSEFLLELPSRSGEFTLKVIITVSATSSFCGLQVRLKMFKILEKDSEMVLDVTFSDVRDVQDCLSWSWNRYL |
Length | 561 |
Position | Head |
Organism | Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Komagataella.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.412 |
Instability index | 43.89 |
Isoelectric point | 5.24 |
Molecular weight | 63993.94 |
Publications | PubMed=19465926
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25783
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.81| 22| 137| 39| 62| 1
---------------------------------------------------------------------------
39- 62 (34.69/28.66) RFED..LKEDELIDEILENHQqpANE
177- 200 (36.12/22.31) RLNDevLKEKMYWDNILETLE..ANE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 147.73| 46| 113| 320| 366| 2
---------------------------------------------------------------------------
320- 366 (69.18/46.09) QLLKEATELISYQVQVDGNKIVVDLGEEiIEIESVLAETQLDDNQVP
436- 481 (78.55/48.42) QLLKNIIEMLIRNIYLDDEKVSEIMGQH.FKLTKHLAEPKSQQNQDP
---------------------------------------------------------------------------
|