<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25777
Description |
Subunit of the RNA polymerase II mediator complex |
Sequence | MNNTPLDELQWKSPEWIQTFGLRTDNVLEYFSQSPFFDRSSNNQVLKMQSQFNEQFQIQLQQNPHFLQQELKKMKGVEFIVAYTQEPNFWVIRKQFRKSPNEADALNDYYIIGANVYMAPVLNDVISSRLLSTTLALRKAMNTLHQMPKFSPTEGHYYHQDTDPYLGDKSRPGTIINTPNIGTTVSNTNLNTPSDKEAADRNTNSSTLISLLNML |
Length | 215 |
Position | Head |
Organism | Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Komagataella.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.619 |
Instability index | 50.53 |
Isoelectric point | 6.08 |
Molecular weight | 24772.57 |
Publications | PubMed=19465926
|
Function
Annotated function |
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP25777
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.39| 25| 49| 12| 37| 2
---------------------------------------------------------------------------
12- 37 (41.57/27.12) KSPEWIQTfGLRTDNVLEY...FSQSPFF
62- 89 (40.82/22.06) QNPHFLQQ.ELKKMKGVEFivaYTQEPNF
---------------------------------------------------------------------------
|