<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25776
| Description |
"Cyclin-dependent protein kinase, component of RNA polymerase II holoenzyme" |
| Sequence | MNRLYNQTQQPMRMASNDFFSIGPYRKRKDQSRESVLDKYTILGYIASGTYGKVFKASGKSKDNQKQFYAIKKFKIDSKDSEITHYTGISQSAIREISLCKELKNENVINLTEIVLENKCIYMISEFAEYDLLQIIHHHSHPDLKPINEQMLKSILFQILQGLNYLHENWIIHRDLKPANIMVTSEGIVKIGDLGLARKFNNLLQTLYTGDKVVVTIWYRSPELLLGARHYTPAIDLWAVGCILAELLSLRPIFKGEEAKIDKKQLPFQENQLLKIIEILGTPTVHSWKSLKDYPEYHQLSKFNIFPPNLSAWFHSMGGQNKNCLGLLSNLLQYDPADRLSAHSALSHDWFSESPAITKNVFKNTKVKYPIRKIQKDDVNLLNQSQQYSNIGQKRAIQDDGSRKRRA |
| Length | 407 |
| Position | Kinase |
| Organism | Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Komagataella.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.448 |
| Instability index | 44.24 |
| Isoelectric point | 9.35 |
| Molecular weight | 46932.46 |
| Publications | PubMed=19465926
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25776
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.36| 21| 29| 133| 154| 1
---------------------------------------------------------------------------
133- 154 (36.25/33.72) LQIIHHH..SHPDLKPINeQMLKS
163- 185 (34.11/25.72) LNYLHENwiIHRDLKPAN.IMVTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.92| 20| 28| 23| 42| 2
---------------------------------------------------------------------------
23- 42 (34.60/22.66) GPYR...KRKDQSRESVLDKYTI
49- 71 (28.78/17.68) GTYGkvfKASGKSKDNQKQFYAI
73- 87 (15.54/ 6.35) .......KFKIDSKDSEITHYT.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.04| 20| 23| 268| 288| 4
---------------------------------------------------------------------------
268- 288 (30.45/22.06) FQENQLLKIIEILgTPTVHSW
294- 313 (38.60/23.23) YPEYHQLSKFNIF.PPNLSAW
---------------------------------------------------------------------------
|