<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25749
Description |
Uncharacterized protein (Fragment) |
Sequence | AGKEVNTASLCRIGQETVQEIVSKTQEVFGLLKTWQLPNGVNPNIHQERQTKLQDLVRQMEVLFRKLRLIYEKCHESTAGLQHSNIEALVPYVEHLEGKHEDSESDSVRYVNEERRDVVEVIKQKNQQLKVLMDQLRELIWDVNAMMVANSARSAVR |
Length | 157 |
Position | Head |
Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.546 |
Instability index | 48.59 |
Isoelectric point | 6.25 |
Molecular weight | 18148.48 |
Publications | PubMed=18563158
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25749
No repeats found
|