<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25747
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MDYEFKLKTAAQREKVEDLFDYEGCKVGRGTYGHVYKAKRKDGSDDKEYALKQIEGTGISMSACREIALLRELKHPNVITLHRVFLSHSDRKVWLLFDFAEHDLWHIIKWHRASKANKKPVPIPRQMVKSLLYQILDGIHYLHANWILHRDLKPANILVMGEGPERGRVKIGMDLLYGSFIKNFSLLRYPLAADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLAARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQEKDWEDIRKMPEHATLMKDFRRSQYQNCCLLKYMEKHKVKADSKAFHLLSKLLTMDPTKRISSDQAMADPYFMEDPQPTSDVFAGVPIPYPKREFLTDEDNDDKTD |
| Length | 390 |
| Position | Kinase |
| Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.455 |
| Instability index | 38.48 |
| Isoelectric point | 8.07 |
| Molecular weight | 45458.97 |
| Publications | PubMed=18563158
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IBA:GO_Central
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IBA:GO_Central
|
| GO - Biological Process | protein phosphorylation GO:0006468 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25747
No repeats found
|