Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MAGDERWNYGNMDMYLPQNPPSSGSISQNYNQQTEPLPHRTDGEPPVTQNGQTSHEDSAFYLLKDMPAAVDITGSVNLIQHHGLEHSFHKFCGKKVKEPLSNFLPNLPGFIDTPGLQDGSSLRSLIEKPPIVGKELYQLSGPQLQGFRLHPGPIPEQYRLLHQQPPAKKKHKNKKHKREHSKTSEGMSVQDSSQSHTDMGASSTTSGEKSEKKTKKQKKHEDSEKKEKKKKKDKKKKKVNMILI |
Length | 244 |
Position | Head |
Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes> Branchiostomidae> Branchiostoma. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.174 |
Instability index | 54.42 |
Isoelectric point | 9.54 |
Molecular weight | 27505.83 |
Publications | PubMed=18563158 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP25735 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 96.51| 30| 41| 168| 199| 1 --------------------------------------------------------------------------- 168- 199 (47.73/24.92) KKKHKNKKHkrEHSKTSEGMSVQDSSQSHTDM 212- 241 (48.78/20.94) KKTKKQKKH..EDSEKKEKKKKKDKKKKKVNM --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 93.79| 25| 35| 105| 130| 2 --------------------------------------------------------------------------- 105- 130 (43.04/29.06) PNLPGFIDTPGlQDGSSLRSLIEKPP 142- 166 (50.76/30.38) PQLQGFRLHPG.PIPEQYRLLHQQPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 91.94| 26| 44| 14| 39| 3 --------------------------------------------------------------------------- 14- 39 (49.85/30.86) MYLPQNPPSSGSISQNYNQ.QTEPLPH 60- 86 (42.09/25.06) FYLLKDMPAAVDITGSVNLiQHHGLEH --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKKTKKQKKHEDSEKKEKKK 2) NYGNMDMY | 211 8 | 230 15 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab