<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25731
| Description |
Mediator of RNA polymerase II transcription subunit 9 (Fragment) |
| Sequence | TVDEKEKETQDKSSESEMVEQAGAGNDMSFHPLVRDIIEEKDMESPNVKQKITELKTKFQKCRALVEGISGIDCSEEEQKQQIEQLKQQVTTKTDLLKKYKNLCAFDCLNHDN |
| Length | 113 |
| Position | Middle |
| Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.001 |
| Instability index | 54.66 |
| Isoelectric point | 4.89 |
| Molecular weight | 12965.41 |
| Publications | PubMed=18563158
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25731
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.47| 28| 35| 33| 65| 1
---------------------------------------------------------------------------
10- 31 (29.16/10.36) ......QDKSSESEMVEQAGAGNDMSFH
33- 60 (46.41/33.33) LVRDIIEEKDMESPNVKQKITELKTKFQ
70- 87 (24.90/10.18) SGIDCSEE...EQ...KQQIEQLK....
---------------------------------------------------------------------------
|