<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25730
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MASDVRVSVEALQENQVQEVSLDGQETYVQPLSMSENLAKLAHRIDFSQEDSDGEVQLEPGEEEEEEEEERKKQEAHWPWESIRDKLRTSLVETNVLLDVLKIAKDKKYMVLDPVSQEPQPSKPVLQYVAKKESLSGAADILQKGADRLAKSQAEFSSGSRGQGDFHRELLKLRQYWRLRRAGNNILGDLSFKSAGSHYWHSGVFEVVKTTEEGMAPGSSPLEVRIPSDLEGNAYIQVVIEDQLETIIAVKAALLPNSRREAAPGEPPWNVKLEAAQNVLFCKELFAQLAREAVQMKSTIPHLVVGNQITSQIFPGVQLSIALCHNTVEEDSKDDTTSPQRCQHNHVLEHALHQMLREVHRSNLNPAPPHPVTAPFSSSKKRRVAGPQGLDRKQCTQLQETEGLLERLEKQAKHTLLRARILDMTDKLAQEVNDPCLQAHVSSIGTSTESSVRIIITSPGYEQICKTMLHVNIGVEDVKVVSKDGKVITLSYDEHELRDLLLHQACQHQVNTVQSLSKMMGWQILHLSNHVGTGPVEKLGNASGIMMASPKGDRVISVRNSPSLGPLVSVQLTRQKGCETWRSDVIKDTKWDQVGGSFKPVQWDKAKGRNFVNKIELLMGCLT |
| Length | 623 |
| Position | Head |
| Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.481 |
| Instability index | 49.40 |
| Isoelectric point | 6.06 |
| Molecular weight | 69508.11 |
| Publications | PubMed=18563158
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25730
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.53| 17| 28| 519| 535| 1
---------------------------------------------------------------------------
519- 535 (34.51/20.80) MM....GWQILHLSNHVGTGP
546- 566 (26.01/14.11) MMaspkGDRVISVRNSPSLGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.43| 11| 46| 216| 226| 3
---------------------------------------------------------------------------
216- 226 (20.20/10.08) APGSSPLEVRI
263- 273 (23.23/12.57) APGEPPWNVKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.49| 16| 17| 406| 421| 4
---------------------------------------------------------------------------
406- 421 (24.46/17.56) ERLEKQAKHTLLRARI
426- 441 (27.03/20.22) DKLAQEVNDPCLQAHV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 120.37| 36| 47| 3| 38| 9
---------------------------------------------------------------------------
3- 38 (57.77/35.61) SDVRVSVEALQENQVQEVSLDGQETYVQPLSMSENL
52- 87 (62.60/39.20) SDGEVQLEPGEEEEEEEEERKKQEAHWPWESIRDKL
---------------------------------------------------------------------------
|