<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25724
| Description |
Uncharacterized protein (Fragment) |
| Sequence | PKNNPSDLPQKVNRSLACQVSSQPGETLQADKWPSKLMMQPIPQQLLVPLGPLFRNSRTVGFHFSNNDQDALRALYRVMEGGFVSI |
| Length | 86 |
| Position | Unknown |
| Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.452 |
| Instability index | 45.50 |
| Isoelectric point | 9.53 |
| Molecular weight | 9606.92 |
| Publications | PubMed=18563158
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25724
No repeats found
No repeats found
|