<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25719
| Description |
Uncharacterized protein |
| Sequence | MSATNSVPNGCSLEDCHSNVFALTDLTGIKWRRLRAPCPAGVGPLEDPILSSFAKCLAADVFCVWRQRELWIFWYGDDPDLTDVLHPELKGTSHRGSCVSIVCFSSGLTAGCCCFLPSLFRYLLSADFVRLGRWFVRPYIQGTDKNDKCEYLSCAFSFFLHGESTVCTSVEIQEHQLVERLSMQHFNSVQGTAGGFHGEKARLELKAT |
| Length | 208 |
| Position | Middle |
| Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.002 |
| Instability index | 29.43 |
| Isoelectric point | 6.15 |
| Molecular weight | 23169.24 |
| Publications | PubMed=18563158
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IBA:GO_Central
|
| GO - Biological Function | sugar transmembrane transporter activity GO:0051119 IBA:GO_Central
|
| GO - Biological Process | carbohydrate transport GO:0008643 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25719
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.90| 15| 33| 113| 127| 1
---------------------------------------------------------------------------
113- 127 (28.47/15.31) CCFLPSLFRYLLSAD
149- 163 (29.42/16.02) CEYLSCAFSFFLHGE
---------------------------------------------------------------------------
|