<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25719
Description |
Uncharacterized protein |
Sequence | MSATNSVPNGCSLEDCHSNVFALTDLTGIKWRRLRAPCPAGVGPLEDPILSSFAKCLAADVFCVWRQRELWIFWYGDDPDLTDVLHPELKGTSHRGSCVSIVCFSSGLTAGCCCFLPSLFRYLLSADFVRLGRWFVRPYIQGTDKNDKCEYLSCAFSFFLHGESTVCTSVEIQEHQLVERLSMQHFNSVQGTAGGFHGEKARLELKAT |
Length | 208 |
Position | Middle |
Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.002 |
Instability index | 29.43 |
Isoelectric point | 6.15 |
Molecular weight | 23169.24 |
Publications | PubMed=18563158
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IBA:GO_Central
|
GO - Biological Function | sugar transmembrane transporter activity GO:0051119 IBA:GO_Central
|
GO - Biological Process | carbohydrate transport GO:0008643 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25719
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.90| 15| 33| 113| 127| 1
---------------------------------------------------------------------------
113- 127 (28.47/15.31) CCFLPSLFRYLLSAD
149- 163 (29.42/16.02) CEYLSCAFSFFLHGE
---------------------------------------------------------------------------
|