<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25718
| Description |
Uncharacterized protein |
| Sequence | MSATNSVPNGCSLEDCHSNVFALTDLTGIKWRRLRAPCPAGVGPLEDPILSSFAKCLAADVFCVWRQRELWIFWYGDDPDLTDVLHPELKDIEQGSWEKELSYECRTLLFKALHNLLERYLLSADFVRLGRWFVRPYIQGTDKNDKCEYLSCAFSFFLHGESTVCTSVEIQEHQLVERLSMQHFNSVQGTAGGFHGEKTRLELKAT |
| Length | 206 |
| Position | Middle |
| Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.228 |
| Instability index | 32.50 |
| Isoelectric point | 5.49 |
| Molecular weight | 23524.49 |
| Publications | PubMed=18563158
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IBA:GO_Central
nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | sugar transmembrane transporter activity GO:0051119 IBA:GO_Central
|
| GO - Biological Process | carbohydrate transport GO:0008643 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25718
No repeats found
No repeats found
|