<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25715
| Description |
Uncharacterized protein |
| Sequence | MEVDPVSKFKLLVPHLKESLVNLMRIAGQNLVHNAAIDNQLKSGDNPSQRVDKNLEEFYSTLDQIELNLRLAQECLTQHQESVRHAPLPVPIMSKPEPSGEGQTMPYGQFLGLARSQVTCAKEIHDALVRCADDLGGKR |
| Length | 139 |
| Position | Tail |
| Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.423 |
| Instability index | 51.69 |
| Isoelectric point | 5.93 |
| Molecular weight | 15468.51 |
| Publications | PubMed=18563158
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25715
No repeats found
No repeats found
|