<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25714
| Description |
Uncharacterized protein |
| Sequence | MAGNFWQSSHCQQWILDKQDLLRDRQDDLTNFPDDEYQKVHIFYCGVIQAVGEQLKLRQQVIATATVYFKRFYSKYSFRTIDPLLMGPTCVFLASKVEEFGVISNSRLITACQTVIKNKFSYAFNQEFPYRINHVLECEFYLLEMMDCCLVVYHPYRPLTSYVQDMGQEDTVLPLAWRIVNDSYRTDVCLLYPPFMIALAALHMACVILQKDAKHWFAELSVDMEKVGVSYAMNSTVILP |
| Length | 240 |
| Position | Kinase |
| Organism | Branchiostoma floridae (Florida lancelet) (Amphioxus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Cephalochordata> Leptocardii> Amphioxiformes>
Branchiostomidae> Branchiostoma.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | 0.027 |
| Instability index | 42.16 |
| Isoelectric point | 5.66 |
| Molecular weight | 27942.08 |
| Publications | PubMed=18563158
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25714
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 54.50| 10| 37| 147| 156| 2
---------------------------------------------------------------------------
121- 130 (15.67/ 8.71) SYAFNQEFPY
147- 156 (21.45/14.59) DCCLVVYHPY
187- 195 (17.39/10.46) DVCL.LYPPF
---------------------------------------------------------------------------
|